Abaecin [123997-18-2]
Référence T80395-5mg
Conditionnement : 5mg
Marque : TargetMol
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
Abaecin
Copy Product InfoAbaecin, an antibacterial peptide, exhibits selective efficacy against an Apidaecin-resistant strain of Xanthomonas [1].
Cas No. 123997-18-2
With extensive experience in compound synthesis, we can provide rapid custom synthesis services for this product according to your research needs.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Abaecin, an antibacterial peptide, exhibits selective efficacy against an Apidaecin-resistant strain of Xanthomonas [1]. |
| Molecular Weight | 3878.44 |
| Formula | C187H270N48O43 |
| Cas No. | 123997-18-2 |
| Sequence | Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr |
| Sequence Short | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |