ACB1, Recombinant, Saccharomyces cerevisiae, aa1-87, His-Tag (Acyl-CoA-binding Protein)

Référence 372120-20ug

Conditionnement : 20ug

Marque : US Biological

Contactez votre distributeur local :


Téléphone : +1 850 650 7790


372120 ACB1, Recombinant, Saccharomyces cerevisiae, aa1-87, His-Tag (Acyl-CoA-binding Protein)

Swiss Prot
P31787
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.

Source:
Recombinant protein corresponding to aa1-87 from full length saccharomyces cerevisiae ACB1, fused to His-Tag at N-terminal, expressed in Yeast.

Molecular Weight:
~12.1kD

Amino Acid Sequence:
MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, Yeast|Purity: ≥90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥90% (SDS-PAGE)
References
1. "Quantitative trait loci mapped to single-nucleotide resolution in yeast." Deutschbauer A.M., Davis R.W.Nat. Genet. 37:1333-1340(2005).