Acidic Protein MsyB, Recombinant, E. coli, aa1-124, His-tag (msyB)

Could participate in the normal pathway of protein export.

Source:
Full-length recombinant protein corresponding to aa1-124 from E. coli Acidic Protein MsyB, fused to His-tag at C-terminal, expressed in Baculovirus.

Molecular Weight:
~16.3kD

Amino Acid Sequence:
MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.