AKT1 antibody - N-terminal region (AVARP06008_P050)
Référence AVARP06008_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
AKT1 Antibody - N-terminal region (AVARP06008_P050)
| Datasheets/Manuals | Printable datasheet for anti-AKT1 (AVARP06008_P050) antibody |
|---|
| Publications | The RNA helicase DDX3 induces neural crest by promoting AKT activity The RNA helicase DDX3 induces neural crest by promoting AKT activity Preprint — no PubMed record available |
|---|---|
| Tested Species Reactivity | Human, Frog, Baboon |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Pig, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AKT1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 100%; Goat: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Sheep: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AKT1 (AVARP06008_P050) antibody is Catalog # AAP30466 |
| Reference | Kim,H.A., et al., (2006) Exp. Mol. Pathol. 80 (2), 165-170 |
|---|---|
| Gene Symbol | AKT1 |
| Gene Full Name | V-akt murine thymoma viral oncogene homolog 1 |
| Alias Symbols | AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA |
| NCBI Gene Id | 207 |
| Protein Name | RAC-alpha serine/threonine-protein kinase |
| Description of Target | AKT1 is a general protein kinase capable of phosphorylating several known proteins.The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene. |
| Uniprot ID | P31749 |
| Protein Accession # | NP_005154 |
| Nucleotide Accession # | NM_005163 |
| Protein Size (# AA) | 480 |
| Molecular Weight | 56kDa |
