ANGPTL3 Antibody - N-terminal region - Biotin
Référence ARP42412_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
ANGPTL3 Antibody - N-terminal region : Biotin (ARP42412_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-ANGPTL3 (ARP42412_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB, IHC |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANGPTL3 (ARP42412_P050-Biotin) antibody is Catalog # AAP42412 (Previous Catalog # AAPP24758) |
| Reference | Kathiresan,S., (2008) Nat. Genet. 40 (2), 189-197 |
|---|---|
| Gene Symbol | ANGPTL3 |
| Gene Full Name | Angiopoietin-like 3 |
| Alias Symbols | ANL3, ANG-5, FHBL2, ANGPT5 |
| NCBI Gene Id | 27329 |
| Protein Name | Angiopoietin-related protein 3 |
| Description of Target | The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil dom |
| Uniprot ID | Q9Y5C1 |
| Protein Accession # | NP_055310 |
| Nucleotide Accession # | NM_014495 |
| Protein Size (# AA) | 460 |
| Molecular Weight | 51kDa |
| Protein Interactions | UBC; ITGAV; ITGB3; ITGA5; |







