Anti-Chicken Allergen Gal d I Polyclonal Antibody

Référence NB-21-40202

Conditionnement : 100µg

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Specifications Anti-Chicken Allergen Gal d I Polyclonal Antibody

Product name ARO-A19850-100
Uniprot ID P01005
Raw Antigen Sequence AEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Allergen Gal d I
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Allergen Gal d I
Product name ARO-A19850-1MG
Uniprot ID P01005
Raw Antigen Sequence AEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Allergen Gal d I
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Allergen Gal d I
Product name ARO-A19850-50
Uniprot ID P01005
Raw Antigen Sequence AEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Allergen Gal d I
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Allergen Gal d I

Documents

QC & Validation

Anti-Chicken Allergen Gal d I Polyclonal Antibody binds to Recombinant Gallus gallus Allergen Gal d I Protein, N-His in WB Assay

Anti-Chicken Allergen Gal d I Polyclonal Antibody binds to Recombinant Gallus gallus Allergen Gal d I Protein, N-His in WB Assay

Recombinant Gallus gallus Allergen Gal d I Protein, N-His(cat. No.ARO-P15710) can bind Anti-Chicken Allergen Gal d I Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Chicken Allergen Gal d I Polyclonal Antibody” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call