Anti-Hex Antibody
Référence MBS178143-0,1mg-DL488
Conditionnement : 0.1mg(Dylight488)
Marque : MyBiosource
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
Anti- Hex Picoband antibody, MBS178143, Western blotting
All lanes: Anti Hex (MBS178143) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: HEPG Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
All lanes: Anti Hex (MBS178143) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: HEPG Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
HEX Antibody – Polyclonal
For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178143Description: Rabbit IgG polyclonal antibody for Hematopoietically-expressed homeobox protein Hhex(HHEX) detection. Tested with WB in Human;Mouse; Rat. Background: Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the… More details
Product Overview
Online Datasheet in PDFProduct Name
Hex, Polyclonal Antibody
Full Product Name
Anti-Hex Antibody
Product Gene Name
anti-Hex antibody
Product Synonym Names
Hematopoietically-expressed homeobox protein Hhex; Hematopoietically expressed homeobox; Hematopoietically-expressed homeobox protein HHEX; HEX; HHEX; HHEX_HUMAN; HMPH; Homeobox hematopoietically expressed; Homeobox protein HEX; Homeobox protein PRH; HOX11L PEN; PRH; PRHX; Proline rich homeodomain containing transcription factor; OTTHUMP00000206478; OTTHUMP00000206479; OTTHUMP00000206480; OTTHUMP00000206482; OTTHUMP00000207360; USURPIN; Usurpin beta; hematopoietically expressed homeobox
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
30,022 Da
OMIM
604420
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-Hex antibody
Western Blot (WB)
Application Notes for anti-Hex antibody
Western Blot Concentration: 0.1-0.5ug/ml
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Western Blot (WB) of anti-Hex antibody
Anti- Hex Picoband antibody, MBS178143, Western blotting
All lanes: Anti Hex (MBS178143) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: HEPG Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
All lanes: Anti Hex (MBS178143) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: HEPG Whole Cell Lysate at 40ug
Predicted bind size: 47KD
Observed bind size: 47KD
Product References and Citations for anti-Hex antibody
1. D'Elia, A. V., Tell, G., Russo, D., Arturi, F., Puglisi, F., Manfioletti, G., Gattei, V., Mack, D. L., Cataldi, P., Filetti, S., Di Loreto, C., Damante, G. Expression and localization of the homeodomain-containing protein HEX in human thyroid tumors. J. Clin. Endocr. Metab. 87: 1376-1383, 2002. 2. Hromas, R., Radich, J., Collins, S. PCR cloning of an orphan homeobox gene (PRH) preferentially expressed in myeloid and liver cells. Biochem. Biophys. Res. Commun. 195: 976-983, 1993.
Other Notes
Small volumes of anti-Hex antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Searchable Terms for Hex purchase
MBS178143 is an antibody targeting Hex. Reactive in Human, Mouse, Rat.
Additional Details
NCBI/Uniprot data below describe general gene information for Hex. It may not necessarily be applicable to this product.
UniProt Primary Accession #
UniProt Related Accession #
GenBank Nucleotide #
NCBI Official Full Name
hematopoietically-expressed homeobox protein HHEX
NCBI Official Synonym Full Names
hematopoietically expressed homeobox
NCBI Official Symbol
HHEX
NCBI Official Synonym Symbols
HEX; PRH; HMPH; PRHX; HOX11L-PEN
UniProt Protein Name
Hematopoietically-expressed homeobox protein HHEX
UniProt Synonym Protein Names
Homeobox protein PRH
Protein Family
Hexachlorocyclohexane dehydrochlorinase
UniProt Gene Name
HHEX
UniProt Synonym Gene Names
HEX; PRH; PRHX; Homeobox protein HEX
UniProt Entry Name
HHEX_HUMAN
NCBI Protein Information
hematopoietically-expressed homeobox protein HHEX
NCBI Summary for Hex
This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq, Jul 2008]
UniProt Comments for Hex
HHEX: Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.
Protein type: DNA-binding; Transcription factor
Chromosomal Location of Human Ortholog: 10q23.33
Cellular Component: cytoplasm; nucleus
Molecular Function: chromatin binding; DNA bending activity; eukaryotic initiation factor 4E binding; protein binding; protein homodimerization activity; sequence-specific DNA binding; TATA-binding protein binding; transcription factor binding
Biological Process: anterior/posterior pattern formation; B cell differentiation; cell differentiation; cell proliferation; embryonic heart tube development; endoderm development; forebrain morphogenesis; in utero embryonic development; interkinetic nuclear migration; mRNA export from nucleus; multicellular organism growth; myeloid leukocyte differentiation; negative regulation of angiogenesis; negative regulation of cyclin-dependent protein kinase activity; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of vascular endothelial growth factor receptor signaling pathway; Notch signaling pathway; pancreas development; poly(A)+ mRNA export from nucleus; positive regulation of transcription from RNA polymerase II promoter; positive regulation of Wnt receptor signaling pathway; regulation of cell proliferation; thyroid gland development; transcription, DNA-dependent; vasculogenesis; Wnt receptor signaling pathway
Show more Protein type: DNA-binding; Transcription factor
Chromosomal Location of Human Ortholog: 10q23.33
Cellular Component: cytoplasm; nucleus
Molecular Function: chromatin binding; DNA bending activity; eukaryotic initiation factor 4E binding; protein binding; protein homodimerization activity; sequence-specific DNA binding; TATA-binding protein binding; transcription factor binding
Biological Process: anterior/posterior pattern formation; B cell differentiation; cell differentiation; cell proliferation; embryonic heart tube development; endoderm development; forebrain morphogenesis; in utero embryonic development; interkinetic nuclear migration; mRNA export from nucleus; multicellular organism growth; myeloid leukocyte differentiation; negative regulation of angiogenesis; negative regulation of cyclin-dependent protein kinase activity; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of vascular endothelial growth factor receptor signaling pathway; Notch signaling pathway; pancreas development; poly(A)+ mRNA export from nucleus; positive regulation of transcription from RNA polymerase II promoter; positive regulation of Wnt receptor signaling pathway; regulation of cell proliferation; thyroid gland development; transcription, DNA-dependent; vasculogenesis; Wnt receptor signaling pathway
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
Product Note
Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Product PubMed Publications
Products associated with anti-Hex antibody
| Reference Product | PubMed Publications |
|---|---|
| CDKAL1 antibody | >101 publications with Hex and CDKAL1 |
| SLC30A8 antibody | >90 publications with Hex and SLC30A8 |
| IGF2BP2 antibody | >77 publications with Hex and IGF2BP2 |
| FOXA2 antibody | >7 publications with Hex and FOXA2 |
| NANOG antibody | >4 publications with Hex and NANOG |
| KDR antibody | >2 publications with Hex and KDR |
| GATA2 antibody | >2 publications with Hex and GATA2 |
| EOMES antibody | >1 publications with Hex and EOMES |
Pathways associated with anti-Hex antibody
| Products by Pathway | Pathway Diagram |
|---|---|
| Maturity Onset Diabetes Of The Young Pathway antibodies | Maturity Onset Diabetes Of The Young Pathway Diagram |
| Maturity Onset Diabetes Of The Young Pathway antibodies | Maturity Onset Diabetes Of The Young Pathway Diagram |
| Transcriptional Misregulation In Cancer Pathway antibodies | Transcriptional Misregulation In Cancer Pathway Diagram |
| Transcriptional Misregulation In Cancer Pathway antibodies | Transcriptional Misregulation In Cancer Pathway Diagram |
Diseases associated with anti-Hex antibody
| Disease Name | Pubmed Publications |
|---|---|
| Diabetes Mellitus, Type 2 Antibodies | >130 publications with Hex and Diabetes Mellitus, Type 2 |
| Brain Diseases Antibodies | >10 publications with Hex and Brain Diseases |
| Liver Diseases Antibodies | >9 publications with Hex and Liver Diseases |
| Kidney Diseases Antibodies | >9 publications with Hex and Kidney Diseases |
| Vascular Diseases Antibodies | >8 publications with Hex and Vascular Diseases |
| Heart Diseases Antibodies | >8 publications with Hex and Heart Diseases |
| Liver Neoplasms Antibodies | >7 publications with Hex and Liver Neoplasms |
| Abnormalities, Multiple Antibodies | >5 publications with Hex and Abnormalities, Multiple |
| Disease Models, Animal Antibodies | >5 publications with Hex and Disease Models, Animal |
| Inflammation Antibodies | >4 publications with Hex and Inflammation |
Organs/Tissues associated with anti-Hex antibody
| Organ/Tissue Name | Pubmed Publications |
|---|---|
| Blood Antibodies | >72 publications with Hex and Blood |
| Liver Antibodies | >59 publications with Hex and Liver |
| Pancreas Antibodies | >43 publications with Hex and Pancreas |
| Thyroid Antibodies | >37 publications with Hex and Thyroid |
| Vascular Antibodies | >27 publications with Hex and Vascular |
| Bone Antibodies | >24 publications with Hex and Bone |
| Heart Antibodies | >17 publications with Hex and Heart |
| Brain Antibodies | >14 publications with Hex and Brain |
| Lung Antibodies | >11 publications with Hex and Lung |
| Bone Marrow Antibodies | >11 publications with Hex and Bone Marrow |