Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> Anti-Human OVOL1 Polyclonal Antibody

Anti-Human OVOL1 Polyclonal Antibody

Imprimer Imprimer
Identifiez-vous

Référence NB-21-37478

Conditionnement : 100µg

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Anti-Human OVOL1 Polyclonal Antibody

Product name ARO-A11975-100
Uniprot ID O14753
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Host species Rabbit
Aliases /Synonyms Anti-hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-A11975
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human OVOL1 (Asp116-Leu267).