ANXA3 Antibody - C-terminal region - HRP

Référence ARP36579_T100-HRP

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

ANXA3 Antibody - C-terminal region : HRP (ARP36579_T100-HRP)

Datasheets/ManualsPrintable datasheet for anti-ANXA3 (ARP36579_T100-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ANXA3
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD
Concentration0.5 mg/ml
Blocking PeptideFor anti-ANXA3 (ARP36579_T100-HRP) antibody is Catalog # AAP36579 (Previous Catalog # AAPP07812)
ReferenceSekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299
Gene SymbolANXA3
Gene Full NameAnnexin A3
Alias SymbolsANX3
NCBI Gene Id306
Protein NameAnnexin A3
Description of TargetThis gene, ANXA3, encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.
Uniprot IDP12429
Protein Accession #NP_005130
Nucleotide Accession #NM_005139
Protein Size (# AA)323
Molecular Weight36kDa
Protein InteractionsUBC; ATF2; SNAP23; STXBP2; STX4; ANXA11; ANXA4; ISG15; EMG1; IGSF21; UBR1; UNC119; TP53; REG3A;