AP3S1 Antibody - N-terminal region - HRP
Référence ARP51935_P050-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
AP3S1 Antibody - N-terminal region : HRP (ARP51935_P050-HRP)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-AP3S1 (ARP51935_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AP3S1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AP3S1 (ARP51935_P050-HRP) antibody is Catalog # AAP51935 (Previous Catalog # AAPY03591) |
| Subunit | sigma-1 |
| Reference | Lefrancois,S., (2004) Dev. Cell 7 (4), 619-625 |
|---|---|
| Gene Symbol | AP3S1 |
| Gene Full Name | Adaptor-related protein complex 3, sigma 1 subunit |
| Alias Symbols | CLAPS3, Sigma3A |
| NCBI Gene Id | 1176 |
| Protein Name | AP-3 complex subunit sigma-1 |
| Description of Target | AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. |
| Uniprot ID | Q92572 |
| Protein Accession # | NP_001275 |
| Nucleotide Accession # | NM_001284 |
| Protein Size (# AA) | 193 |
| Molecular Weight | 22kDa |
| Protein Interactions | UBC; STAU1; EGFR; RABL6; AP3M1; SSSCA1; SMC4; AP3D1; AP3B1; KRT7; FLNC; ECT2; ELAVL1; SLC30A3; AP3S2; SCARB2; AP3B2; IRS1; |




