Ap4s1 Antibody - N-terminal region - HRP

Référence ARP52284_P050-HRP

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Ap4s1 Antibody - N-terminal region : HRP (ARP52284_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-Ap4s1 (ARP52284_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ap4s1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI
Concentration0.5 mg/ml
Blocking PeptideFor anti-Ap4s1 (ARP52284_P050-HRP) antibody is Catalog # AAP52284
Gene SymbolAp4s1
Gene Full Nameadaptor-related protein complex 4, sigma 1 subunit
Alias Symbols-
NCBI Gene Id366618
Protein NameProtein Ap4s1 Ensembl ENSRNOP00000007887
Description of TargetThe function of this protein remains unknown.
Uniprot IDF1M5X2
Protein Accession #NP_001124471
Nucleotide Accession #NM_001130999
Protein Size (# AA)144
Molecular Weight15kDa