aroD Recombinant Protein
Référence OPCA02885-100UG
Conditionnement : 100ug
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
AROD Recombinant Protein (Salmonella typhi) (OPCA02885)
| Datasheets/Manuals | Printable datasheet for AROD Recombinant Protein (Salmonella typhi) (OPCA02885) |
|---|
| Predicted Species Reactivity | Salmonella enterica|Salmonella typhi |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA |
| Source | Yeast |
| Gene Symbol | aroD |
|---|---|
| Gene Full Name | 3-dehydroquinase |
| Alias Symbols | STY1760, Type I dehydroquinase, Type I DHQase. |
| NCBI Gene Id | 1248131 |
| Protein Name | 3-dehydroquinate dehydratase |
| Description of Target | Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site. |
| Uniprot ID | P24670 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 29.6 kDa |