Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO)
Référence TMPH-01058-200ug
Conditionnement : 200ug
Marque : TargetMol
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO)
(Synonyms: FALL39, Cathelicidin antimicrobial peptide, CAP18, CAMP, 18 kDa cationic antimicrobial protein (CAP-18;hCAP-18)) Copy Product InfoBinds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 24.7 kDa and the accession number is P49913.
For research use only—not for human use. No sales to individuals. Use as intended only.
User Guide of Recombinant Proteins
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 24.7 kDa and the accession number is P49913. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-10xHis-SUMO, C-Myc |
| Accession Number | P49913 |
| Amino Acid | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Construction | 132-170 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | FALL39, Cathelicidin antimicrobial peptide, CAP18, CAMP, 18 kDa cationic antimicrobial protein (CAP-18;hCAP-18) |
| Research Background | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. |
| Molecular Weight | 24.7 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |