Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> CD292 / BMPR1A, N-His, recombinant protein

CD292 / BMPR1A, N-His, recombinant protein

Imprimer Imprimer
Identifiez-vous

Référence NB-21-25748

Conditionnement : 100ug

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

CD292 / BMPR1A, N-His, recombinant protein

Product name CD292 / BMPR1A, N-His, recombinant protein
Uniprot ID P36894
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSI
Molecular weight 16.50 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Gln24-Arg152
Protein Accession P36894
Reference PX-P5610
Note For research use only
Molecular Constructor
His Gln24–Arg152