Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> CD9 Recombinant Protein

CD9 Recombinant Protein

Imprimer Imprimer
Identifiez-vous

Référence NB-21-24437

Conditionnement : 100ug

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

CD9 Recombinant Protein

Product name PX-P4076-100
Uniprot ID P21926
Uniprot link http://www.uniprot.org/uniprot/P21926
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 10.5kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Host species Escherichia coli (E.coli)
Fragment Type Ser112~Ile195
Aliases /Synonyms MIC3, TSPAN29
Reference PX-P4076
Note For research use only.
Molecular Constructor
Ser112~Ile195 His