CEBPG (CCAAT/Enhancer Binding Protein (C/EBP), gamma, GPE1BP, IG/EBP-1)
Référence 244588-100ug
Conditionnement : 100ug
Marque : US Biological
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
244588CEBPG (CCAAT/Enhancer Binding Protein (C/EBP), gamma, GPE1BP, IG/EBP-1)
Specifications
The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. [provided by RefSeq
Applications:
Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested.
Recommended Dilutions:
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence:
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ
Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.