- More Files
- Specification
Product Description
Human DBI full-length ORF ( NP_065438.1, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.2
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — DBI
Entrez GeneID
1622GeneBank Accession#
NM_020548.4Protein Accession#
NP_065438.1Gene Name
DBI
Gene Alias
ACBD1, ACBP, CCK-RP, EP, MGC70414
Gene Description
diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)
Omim ID
125950Gene Ontology
HyperlinkGene Summary
This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
GABA receptor modulator|acyl coenzyme A binding protein|acyl-Coenzyme A binding domain containing 1|cholecystokinin-releasing peptide, trypsin-sensitive|diazepam binding inhibitor|diazepam binding inhibitor, splice form 1c|endozepine
- Interactome
- Pathway
- Disease