DHX35 Antibody - N-terminal region

Référence ARP36485_P050-25UL

Conditionnement : 25ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-DHX35 (ARP36485_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DHX35
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-DHX35 (ARP36485_P050) antibody is Catalog # AAP36485 (Previous Catalog # AAPP08542)
ReferenceJurica,M.S., (2002) RNA 8 (4), 426-439
Gene SymbolDHX35
Gene Full NameDEAH (Asp-Glu-Ala-His) box polypeptide 35
Alias SymbolsDDX35, C20orf15, KAIA0875
NCBI Gene Id60625
Protein NameProbable ATP-dependent RNA helicase DHX35
Description of TargetDEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of this gene product which is a member of this family, has not been determined.
Uniprot IDQ9H5Z1
Protein Accession #NP_068750
Nucleotide Accession #NM_021931
Protein Size (# AA)703
Molecular Weight79kDa
Protein InteractionsUBC; Prpf8;
  1. What is the species homology for "DHX35 Antibody - N-terminal region (ARP36485_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "DHX35 Antibody - N-terminal region (ARP36485_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DHX35 Antibody - N-terminal region (ARP36485_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DHX35 Antibody - N-terminal region (ARP36485_P050)"?

    This target may also be called "DDX35, C20orf15, KAIA0875" in publications.

  5. What is the shipping cost for "DHX35 Antibody - N-terminal region (ARP36485_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "DHX35 Antibody - N-terminal region (ARP36485_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DHX35 Antibody - N-terminal region (ARP36485_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "79kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DHX35 Antibody - N-terminal region (ARP36485_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DHX35"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DHX35"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DHX35"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DHX35"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DHX35"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DHX35"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
A4398-20
 20uL 
ARP40613_P050-25UL
 25ul 
CSB-PA887985LA01HU-50ug
 50ug