E6 Recombinant Protein
Référence OPCA02960-20UG
Conditionnement : 20ug
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
E6 Recombinant Protein (Human papillomavirus type 16) (OPCA02960)
| Datasheets/Manuals | Printable datasheet for E6 Recombinant Protein (Human papillomavirus type 16) (OPCA02960) |
|---|
| Predicted Species Reactivity | Human papillomavirus type 16|Human Papillomavirus Type 16 |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
| Source | Yeast |
| Gene Symbol | E6 |
|---|---|
| Gene Full Name | protein E6*;transforming protein E6 |
| Alias Symbols | HpV16gp1, protein E6*;transforming protein E6. |
| NCBI Gene Id | 1489078 |
| Protein Name | Protein E6 |
| Description of Target | Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway. |
| Uniprot ID | P03126 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 21.2 kDa |