EDIL3 (Integrin-binding Protein DEL1, Developmentally-regulated Endothelial Cell Locus 1 Protein, EGF-like Repeat and Discoidin I-like Domain-containing Protein 3, DEL1) (Biotin)
Référence 126160-Biotin-100ul
Conditionnement : 100ul
Marque : US Biological
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
126160-BiotinEDIL3 (Integrin-binding Protein DEL1, Developmentally-regulated Endothelial Cell Locus 1 Protein, EGF-like Repeat and Discoidin I-like Domain-containing Protein 3, DEL1) (Biotin)
Specifications
EDIL3 is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior.
Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.