Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (Biotin)

EFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (Biotin)

Imprimer Imprimer
Identifiez-vous

Référence 126188-Biotin-100ul

Conditionnement : 100ul

Marque : US Biological

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

126188-BiotinEFHD1 (EF-hand Domain-containing Protein D1, EF-hand Domain-containing Protein 1, Swiprosin-2, SWS2, PP3051) (Biotin)

Specifications
Clone TypeMonoclonal
Hostmouse
Sourcehuman
IsotypeIgG2a,k
GradeAffinity Purified
ApplicationsE IHC WB
CrossreactivityHu Mo Rt
Accession #NM_025202, NP_079478.1
Shipping TempBlue Ice
Storage Temp-20°C

EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).

Applications:
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG2a,k|Clone No: 1H7|Host: mouse|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.|Purity: Purified by Protein A affinity chromatography.|Immunogen: Full length recombinant corresponding to aa168-238 from human EFHD1 (NP_079478) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human EFHD1. Species Crossreactivity: mouse and rat.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Full length recombinant corresponding to aa168-238 from human EFHD1 (NP_079478) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human EFHD1. Species Crossreactivity: mouse and rat.