EGFP Protein - Enhanced green fluorescent protein(egfp)

Référence NB-21-24547

Conditionnement : 50ug

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

EGFP Protein - Enhanced green fluorescent protein(egfp)

Product name PX-P4577-1MG
Uniprot ID C5MKY7
Uniprot link https://www.uniprot.org/uniprot/C5MKY7
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239
Protein Accession C5MKY7
NCBI Reference AAK15492
Reference PX-P4577
Note For research use only.
Molecular Constructor
Met1–Lys239 His