Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> EIF4G1 (Eukaryotic Translation Initiation Factor 4 gamma 1, eIF-4-gamma 1, eIF-4G 1, eIF-4G1, p220, EIF4G1, EIF4F, EIF4G, EIF4GI) (HRP)

EIF4G1 (Eukaryotic Translation Initiation Factor 4 gamma 1, eIF-4-gamma 1, eIF-4G 1, eIF-4G1, p220, EIF4G1, EIF4F, EIF4G, EIF4GI) (HRP)

Imprimer Imprimer
Identifiez-vous

Référence 126246-HRP-100ul

Conditionnement : 100ul

Marque : US Biological

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

126246-HRPEIF4G1 (Eukaryotic Translation Initiation Factor 4 gamma 1, eIF-4-gamma 1, eIF-4G 1, eIF-4G1, p220, EIF4G1, EIF4F, EIF4G, EIF4GI) (HRP)

Specifications
Clone TypeMonoclonal
Hostmouse
Sourcehuman
IsotypeIgG2b,k
GradeAffinity Purified
ApplicationsE WB
CrossreactivityHu Mo Rt
Accession #NM_182917, NP_886553
Shipping TempBlue Ice
Storage Temp-20°C

EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG2b,k|Clone No: 2A9|Host: mouse|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa1500-1599 from human EIF4G1 (NP_886553) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human EIF4G1. Species Crossreactivity: mouse and rat.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa1500-1599 from human EIF4G1 (NP_886553) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human EIF4G1. Species Crossreactivity: mouse and rat.