OPCA02569-100UG | EMC9 Recombinant Protein Biovalley

EMC9 Recombinant Protein (Human) (OPCA02569)

Datasheets/Manuals	Printable datasheet for EMC9 Recombinant Protein (Human) (OPCA02569)

Product Info
Predicted Species Reactivity	Homo sapiens\|Human
Product Format	Liquid or Lyophilized powder
Host	Human
Reconstitution and Storage	-20°C or -80°C
Formulation	20 mM Tris-HCl based buffer, pH 8.0
Purity	Greater than 90% as determined by SDS-PAGE.
Peptide Sequence	MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA
Protein Sequence	MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source	E.coli
Protein Range	1-208 aa
Tag	N-terminal 6xHis-SUMO-tagged

Reference	Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.Genome Res. 10:703-713(2000)
Gene Symbol	EMC9
Gene Full Name	ER membrane protein complex subunit 9
Alias Symbols	C14orf122, CGI-112, ER membrane protein complex subunit 9, FAM158A, family with sequence similarity 158, member A, Protein FAM158A, UPF0172 protein FAM158A.
NCBI Gene Id	51016
Protein Name	ER membrane protein complex subunit 9
Uniprot ID	Q9Y3B6
Protein Accession #	NP_057133.2
Nucleotide Accession #	NM_016049.3
Protein Size (# AA)	Full Length
Molecular Weight	39.1 kDa