ENTH (Clathrin Interactor 1, Epsin-4, Epsin-related Protein, EpsinR, Enthoprotin, Clathrin-interacting Protein Localized in the Trans-Golgi region, Clint, KIAA0171, EPNR, EPN4, CLINT1) (FITC)

One of the main pathways by which membrane components and proteins are taken into a cell is through clathrin-mediated endocytosis. This pathway leads to the building and formation of clathrin-coated pits, also known as CCVs. Enthoprotin is a highly enriched protein localized on the CCVs, interacting with AP1 and Arf-binding protein 2, both clathrin adaptors. Through the binding of the clathrin heavy chain by its COOH-terminal domain, Enthoprotin induces clathrin production. Abnormalities in the gene encoding for Enthoprotin affect genetic susceptibility to Schizophrenia type I, a highly heritable psychosis. Enthoprotin is expressed throughout tissue types at intermediate to low levels.

Applications:
Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKH

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.