fbpB Recombinant Protein
Référence OPCA02853-100UG
Conditionnement : 100ug
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
FBPB Recombinant Protein (Mycobacterium tuberculosis) (OPCA02853)
| Datasheets/Manuals | Printable datasheet for FBPB Recombinant Protein (Mycobacterium tuberculosis) (OPCA02853) |
|---|
| Predicted Species Reactivity | Mycobacterium tuberculosis |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG |
| Source | Yeast |
| Alias Symbols | 30 kDa extracellular protein, Acyl-CoA:diacylglycerol acyltransferase, Antigen 85 complex B, Extracellular alpha-antigen, Fibronectin-binding protein B. |
|---|---|
| Protein Name | Diacylglycerol acyltransferase/mycolyltransferase Ag85B |
| Description of Target | The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM (By similarity). |
| Uniprot ID | P9WQP0 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 32.7 kDa |