- Specifications
Product Description
Human FSHR partial ORF ( NP_000136, 18 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.07
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — FSHR
Entrez GeneID
2492GeneBank Accession#
NM_000145Protein Accession#
NP_000136Gene Name
FSHR
Gene Alias
FSHRO, LGR1, MGC141667, MGC141668, ODG1
Gene Description
follicle stimulating hormone receptor
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to family 1 of G-protein coupled receptors. It is the receptor for follicle stimulating hormone and functions in gonad development. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
FSH receptor|follitropin receptor
- Interactomes
- Pathways
- Diseases
FSHR (Human) Recombinant Protein (Q01)
Référence H00002492-Q01-25ug
Conditionnement : 25ug
Marque : Abnova
Images


