FUT8 antibody - N-terminal region

Référence ARP60784_P050

Conditionnement : 100ul

Marque : Aviva Systems Biology

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

FUT8 Antibody - N-terminal region (ARP60784_P050)

Datasheets/ManualsPrintable datasheet for anti-FUT8 (ARP60784_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR
Concentration0.5 mg/ml
Blocking PeptideFor anti-FUT8 (ARP60784_P050) antibody is Catalog # AAP60784 (Previous Catalog # AAPP48225)
Gene SymbolFUT8
Gene Full NameFucosyltransferase 8 (alpha (1,6) fucosyltransferase)
Alias SymbolsCDGF, CDGF1
NCBI Gene Id2530
Protein NameAlpha-(1,6)-fucosyltransferase
Description of TargetThis gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants.
Uniprot IDQ9BYC5
Protein Accession #NP_004471
Nucleotide Accession #NM_004480
Protein Size (# AA)412
Molecular Weight47kDa
Protein InteractionsUBC; env; ACIN1; SLC25A17; RPL27; DHX15;

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
ARP46705_T100
 100ul 
ARP48845_P050
 100ul 
ARP45410_P050
 100ul