FUT8 antibody - N-terminal region
Référence ARP60784_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
FUT8 Antibody - N-terminal region (ARP60784_P050)
| Datasheets/Manuals | Printable datasheet for anti-FUT8 (ARP60784_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-FUT8 (ARP60784_P050) antibody is Catalog # AAP60784 (Previous Catalog # AAPP48225) |
| Gene Symbol | FUT8 |
|---|---|
| Gene Full Name | Fucosyltransferase 8 (alpha (1,6) fucosyltransferase) |
| Alias Symbols | CDGF, CDGF1 |
| NCBI Gene Id | 2530 |
| Protein Name | Alpha-(1,6)-fucosyltransferase |
| Description of Target | This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. |
| Uniprot ID | Q9BYC5 |
| Protein Accession # | NP_004471 |
| Nucleotide Accession # | NM_004480 |
| Protein Size (# AA) | 412 |
| Molecular Weight | 47kDa |
| Protein Interactions | UBC; env; ACIN1; SLC25A17; RPL27; DHX15; |






