GFP-like Non-Fluorescent Chromoprotein FP595, Recombinant, Anemonia sulcata, aa1-62, GST-Tag
Référence 584662-100ug
Conditionnement : 100ug
Marque : US Biological
584662 GFP-like Non-Fluorescent Chromoprotein FP595, Recombinant, Anemonia sulcata, aa1-62, GST-Tag
Swiss Prot
Q9GZ28Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CPigment protein that is intensely purple in color.
Source:
Recombinant protein corresponding to aa1-62 from Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595, fused to GST-Tag at N-terminal, expressed in E.coli.
Molecular Weight:
~33.5kD
Amino Acid Sequence:
MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥85% (SDS-PAGE)

