Biovalley > HMGCS2 antibody - N-terminal region
HMGCS2 antibody - N-terminal region
Référence ARP41562_T100
Conditionnement : 100ul
Marque : Aviva Systems Biology
HMGCS2 Antibody - N-terminal region (ARP41562_T100)
| Datasheets/Manuals | Printable datasheet for anti-HMGCS2 (ARP41562_T100) antibody |
|---|
| Publications | Possible role of intestinal fatty acid oxidation in the eating-inhibitory effect of the PPAR-α agonist Wy-14643 in high-fat diet fed rats Authors: Karimian Azari, E., Leitner, C., et al. Journal: PLoS One. 8, e74869 (2013) Diacylglycerol acyltransferase-1 inhibition enhances intestinal fatty acid oxidation and reduces energy intake in rats Authors: Schober, G., Arnold, M., et al. Journal: J Lipid Res. 54, 1369-84 (2013) |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCS2 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-HMGCS2 (ARP41562_T100) antibody is Catalog # AAP41562 (Previous Catalog # AAPP24247) |
| Reference | Bouchard,L., (2001) Pediatr. Res. 49 (3), 326-331 |
|---|---|
| Gene Symbol | HMGCS2 |
| Gene Full Name | 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) |
| NCBI Gene Id | 3158 |
| Protein Name | Hydroxymethylglutaryl-CoA synthase, mitochondrial |
| Description of Target | HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase. |
| Uniprot ID | P54868 |
| Protein Accession # | NP_005509 |
| Nucleotide Accession # | NM_005518 |
| Protein Size (# AA) | 508 |
| Molecular Weight | 56kDa |
| Protein Interactions | UBC; APP; YWHAQ; |
Protein interactions
| Name | # of Products |
|---|---|
| YWHAQ | 716 |
Biological pathways
| Name | # of Products |
|---|---|
| Acetoacetic acid biosynthetic process | 12 |
| Cholesterol biosynthetic process | 71 |
| Isoprenoid biosynthetic process | 23 |
| Ketone body biosynthetic process | 12 |
Biological process
| Name | # of Products |
|---|---|
| Adipose tissue development | 20 |
| Brain development | 170 |
| Cellular ketone body metabolic process | 5 |
| Cellular lipid metabolic process | 114 |
| Cellular response to amino acid stimulus | 46 |
| Cellular response to fatty acid | 4 |
| Cellular response to glucocorticoid stimulus | 16 |
| Cellular response to hormone stimulus | 35 |
| Cellular response to insulin stimulus | 69 |
| Cellular response to lipopolysaccharide | 64 |
| Cellular response to organic cyclic compound | 58 |
| Cholesterol biosynthetic process | 37 |
| Isoprenoid biosynthetic process | 14 |
| Ketone body biosynthetic process | 5 |
| Kidney development | 92 |
| Liver development | 83 |
| Lung development | 105 |
| Midgut development | 15 |
| Multicellular organismal response to stress | 9 |
| Response to bacterium | 31 |
| Response to cAMP | 56 |
| Response to drug | 323 |
| Response to ethanol | 105 |
| Response to glucagon stimulus | 10 |
| Response to growth hormone stimulus | 12 |
| Response to linoleic acid | 2 |
| Response to metal ion | 8 |
| Response to monosaccharide stimulus | 2 |
| Response to nutrient | 95 |
| Response to prostaglandin F stimulus | 1 |
| Response to starvation | 25 |
| Response to temperature stimulus | 9 |
| Response to testosterone stimulus | 23 |
| Response to triglyceride | 2 |
| Small molecule metabolic process | 825 |
Cellular components
| Name | # of Products |
|---|---|
| Mitochondrial inner membrane | 251 |
| Mitochondrial matrix | 185 |
| Mitochondrion | 1154 |
Protein function
| Name | # of Products |
|---|---|
| Hydroxymethylglutaryl-CoA synthase activity | 6 |
| Transferase activity | 1042 |
Diseases
| Name | # of Products |
|---|---|
| Disease mutation | 5332 |
-
HMGCS2 Antibody - C-terminal region (ARP41563_T100)Catalog #: ARP41563_T100Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
HMGCS2 Antibody - C-terminal region (OAAB03887)Catalog #: OAAB03887Application: FC,IHC-P,WBFormat: Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. -
HMGCS2 Recombinant Protein (OPCD00161)Catalog #: OPCD00161Conjugation: UnconjugatedApplication: Ctrl (+), SDS-PAGE, WBFormat: Freeze-dried Powder. PBS, pH7.4, containing 0.01% SKL, 5% Trehalose.


