Human CD85d-LILRB2/ILT4 recombinant protein
Référence NB-21-26310
Conditionnement : 100ug
Conditionnement : 100ug
| Product name | Human CD85d-LILRB2/ILT4 recombinant protein |
|---|---|
| Uniprot ID | Q8N423 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Raw Antigen Sequence | MTPIVTVLICLGLSLGPRTRVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPGPEDQPLTPTGSDPQSGLGRHLGVV |
| Molecular weight | 50.88 kDa |
| Protein delivered with Tag? | C-Terminal His Tag |
| Purity estimated | >85% by SDS-PAGE |
| Buffer | 0.01M PBS, pH 7.4. |
| Delivery condition | Dry Ice |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Mammalian cells |
| Fragment Type | Met1-Val461 |
| Aliases /Synonyms | CD85 antigen-like family member D, Monocyte/macrophage immunoglobulin-like receptor 10, MIR-10, ILT4, LIR-2, ILT-4, Immunoglobulin-like transcript 4, MIR10, CD85d, Leukocyte immunoglobulin-like receptor subfamily B member 2, Leukocyte immunoglobulin-like receptor 2, LIR2, LILRB2 |
| Reference | PX-P6217 |
| Note | For research use only |
| Molecular Constructor | Met1–Val461 His |