Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> Human IZUMO1R recombinant protein

Human IZUMO1R recombinant protein

Imprimer Imprimer
Identifiez-vous

Référence NB-21-27776

Conditionnement : 100µg

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
A6ND01
Molecular weight:
26.94 kDa
Gly20–Ser228 His

Specifications Human IZUMO1R recombinant protein

Product name PX-P6535-100
Uniprot ID A6ND01
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
Molecular weight 26.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-Ser228
Aliases /Synonyms JUNO, Sperm-egg fusion protein Juno, FOLR4, IZUMO1R, Folate receptor delta, FR-delta, Folate receptor 4IZUMO1 receptor protein JUNO,
Reference PX-P6535
Molecular Constructor
Gly20–Ser228 His
Product name PX-P6535-1MG
Uniprot ID A6ND01
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
Molecular weight 26.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-Ser228
Aliases /Synonyms JUNO, Sperm-egg fusion protein Juno, FOLR4, IZUMO1R, Folate receptor delta, FR-delta, Folate receptor 4IZUMO1 receptor protein JUNO,
Reference PX-P6535
Molecular Constructor
Gly20–Ser228 His
Product name PX-P6535-50
Uniprot ID A6ND01
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFAS
Molecular weight 26.94 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly20-Ser228
Aliases /Synonyms JUNO, Sperm-egg fusion protein Juno, FOLR4, IZUMO1R, Folate receptor delta, FR-delta, Folate receptor 4IZUMO1 receptor protein JUNO,
Reference PX-P6535
Molecular Constructor
Gly20–Ser228 His

Reviews

There are no reviews yet.

Be the first to review “Human IZUMO1R recombinant protein” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call