Human Small muscular (SMPX) Recombinant Protein
Référence orb1647550-100ug
Conditionnement : 100ug
Marque : Biorbyt
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
Description
Images & Validation
−
Key Properties
−| Species/Host | E. coli |
|---|---|
| Immunogen | Expression Region:1-88aa; Sequence Info:Full Length |
| Tag | N-terminal GST-tagged |
| MW | 36.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
|---|---|
| Buffer/Preservatives | Tris-based buffer50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Stretch-responsive skeletal muscle protein
−
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide