Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> IL13 (Interleukin-13, Interleukin 13, NC30, IL-13, MGC116786, MGC116788, MGC116789) (APC)

IL13 (Interleukin-13, Interleukin 13, NC30, IL-13, MGC116786, MGC116788, MGC116789) (APC)

Imprimer Imprimer
Identifiez-vous

Référence 128389-APC-100ul

Conditionnement : 100ul

Marque : US Biological

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

128389-APCIL13 (Interleukin-13, Interleukin 13, NC30, IL-13, MGC116786, MGC116788, MGC116789) (APC)

Specifications
Clone TypeMonoclonal
Hostmouse
Sourcehuman
IsotypeIgG2a,k
GradeAffinity Purified
ApplicationsFLISA IHC WB
CrossreactivityHu
Accession #NP_002179
Shipping TempBlue Ice
Storage Temp4°C Do Not Freeze

Interleukin-13 (IL-13) is an immunoregulatory protein produced by activated T lymphocytes. The biological activities of IL-13 include the stimulation of B cell proliferation and immunoglobulins production.

Applications:
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilutions:
Immunohistochemistry: Formalin fixed, paraffin embedded tissues
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG2a,k|Clone No: 3H7|Host: mouse|Source: human|Concentration: As Reported|Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Full length recombinant corresponding to aa1-146 from human IL13 with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human IL13.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Full length recombinant corresponding to aa1-146 from human IL13 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human IL13.