IYD Antibody - N-terminal region
Référence ARP66837_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
IYD Antibody - N-terminal region (ARP66837_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-IYD (ARP66837_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Rat, Cow, Dog, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human IYD |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 77%; Dog: 79%; Human: 100%; Rabbit: 79%; Rat: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: NADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-IYD (ARP66837_P050) antibody is Catalog # AAP66837 |
| Gene Symbol | IYD |
|---|---|
| Alias Symbols | TDH4, IYD-1, DEHAL1, C6orf71 |
| NCBI Gene Id | 389434 |
| Protein Name | Iodotyrosine dehalogenase 1 |
| Description of Target | This gene encodes an enzyme that catalyzes the oxidative NADPH-dependent deiodination of mono- and diiodotyrosine, which are the halogenated byproducts of thyroid hormone production. The N-terminus of the protein functions as a membrane anchor. Mutations in this gene cause congenital hypothyroidism due to dyshormonogenesis type 4, which is also referred to as deiodinase deficiency, or iodotyrosine dehalogenase deficiency, or thyroid hormonogenesis type 4. |
| Uniprot ID | Q6PHW0-3 |
| Protein Accession # | NP_001158167 |
| Nucleotide Accession # | NM_001164695 |
| Protein Size (# AA) | 247 |
| Molecular Weight | 27kDa |
| Protein Interactions | TRIM69; |