Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.
 
> K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)

K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)

Imprimer Imprimer
Identifiez-vous

Référence 405969-100ug

Conditionnement : 100ug

Marque : US Biological

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

405969 K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)

K99 Fimbrial Protein, Recombinant, E. coli, aa23-181
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Swiss Prot
P18103
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae.

Source:
Recombinant protein corresponding to aa23-181 from E. coli K99 fimbrial protein, expressed in E. coli.

Molecular Weight:
~16.5kD

AA Sequence:
NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ~90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
~90% (SDS-PAGE)
References
1. "The penultimate tyrosine residue of the K99 fibrillar subunit is essential for stability of the protein and its interaction with the periplasmic carrier protein." Simons B.L., Rathman P., Maij C.R., Oudega B., de Graaf F.K. FEMS Microbiol. Lett. 55:107-112(1990)