LPA Antibody - N-terminal region
Référence ARP60282_P050-25UL
Conditionnement : 25ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
LPA Antibody - N-terminal region (ARP60282_P050)
| Datasheets/Manuals | Printable datasheet for anti-LPA (ARP60282_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LPA |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-LPA (ARP60282_P050) antibody is Catalog # AAP60282 (Previous Catalog # AAPP46470) |
| Gene Symbol | LPA |
|---|---|
| Gene Full Name | Lipoprotein, Lp(a) |
| Alias Symbols | LP, AK38, APOA |
| NCBI Gene Id | 4018 |
| Protein Name | Apolipoprotein(a) |
| Description of Target | LPA is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that attach to atherosclerotic lesions and promote thrombogenesis. Elevated plasma levels of this protein are linked to atherosclerosis. Depending on the individual, the protein contains 2-43 copies of kringle-type domains. |
| Uniprot ID | P08519 |
| Protein Accession # | EAW47596 |
| Nucleotide Accession # | NM_005577 |
| Protein Size (# AA) | 1169 |
| Molecular Weight | 120kDa |
| Protein Interactions | CANX; FBLN5; MMP12; LRP2; APOH; FN1; FGB; ELANE; CELA1; |
