M Recombinant Protein
Référence OPCA02875-20UG
Conditionnement : 20ug
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
M Recombinant Protein (RABV) (OPCA02875)
| Datasheets/Manuals | Printable datasheet for M Recombinant Protein (RABV) (OPCA02875) |
|---|
| Predicted Species Reactivity | Rabies Virus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE |
| Source | Yeast |
| Alias Symbols | Phosphoprotein M2. |
|---|---|
| Protein Name | Matrix protein |
| Description of Target | Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons (By similarity). |
| Uniprot ID | P15200 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 25.2 kDa |