Mast Cell Protease 1, Recombinant, Rat, aa21-260, Myc-Tag

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. May participate in generating perivascular beta-protein which ultimately aggregates into amyloid-beta deposits.

Source:
Recombinant protein corresponding to aa21-260 from rat Mast cell protease 1, fused to Myc-Tag at N-terminal, expressed in E.coli.

Molecular Weight:
~28.6kD

Amino Acid Sequence:
IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.