TP302180 | MCP1 (CCL2) (NM_002982) Human Recombinant Protein Biovalley

MCP1 (CCL2) (NM_002982) Human Recombinant Protein

MVPro

Full-length human proteins expressed in HEK293T cells

Be the first to review this product

SKU

TP302180

Recombinant protein of human chemokine (C-C motif) ligand 2 (CCL2), 20 µg

Specifications
Product Data
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	Protein Sequence >RC202180 protein sequence Red=Cloning site Green=Tags(s) MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIV AKEICADPKQKWVQDSMDHLDKQTQTPKT myc-FLAG tag
Tag	C-Myc/DDK
Predicted MW	10.8 kDa
Concentration	>0.05 µg/µL as determined by microplate BCA method
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note	For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage	Store at -80°C.
Stability	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping	Dry Ice
Reference Data
RefSeq	NP_002973
Locus ID	6347
UniProt ID	P13500
Cytogenetics	17q12
RefSeq Size	760
RefSeq ORF	297
Synonyms	GDCF-2; HC11; HSMCR30; MCAF; MCP-1; MCP1; SCYA2; SMC-CF
Summary	This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and basophils but not for neutrophils or eosinophils. It has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis and atherosclerosis. It binds to chemokine receptors CCR2 and CCR4. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS‐CoV‐2) infection. provided by RefSeq, Aug 2020
Protein Categories	Chemokines, Cytokines, Growth Factors, Secreated Proteins
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway

FAQs
Protein FAQs
SDS
SDS for TP302180

Recombinant Protein Resources
Video tutorial: Why protein expression host matters Webinar Video: Overexpression lysate as positive controls for Western blot Product Overview Video: Overexpression lysates as positive controls for Western blot Video Tutorial: Knockout(KO) lysate and antibody specificity Product Brochure: Protein

SKU	Description	Size
PH302180	CCL2 MS Standard C13 and N15-labeled recombinant protein (NP_002973)	10 ug
LC401046	Lyophilized CCL2 HEK293T cell transient overexpression lysate (as WB positive control)	20 ug
LY401046	Transient overexpression lysate of chemokine (C-C motif) ligand 2 (CCL2) (as WB positive control)	100 ug
TP723718	Purified recombinant protein of Human chemokine (C-C motif) ligand 2 (CCL2 / MCP-1)	10 ug

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

MCP1 (CCL2) (NM_002982) Human Recombinant Protein

Référence TP302180

Contactez votre distributeur local :

MCP1 (CCL2) (NM_002982) Human Recombinant Protein

Citations

Vous serez peut-être également intéressé par les produits suivants :

MCP1 (CCL2) (NM_002982) Human Recombinant Protein

Référence TP302180

Contactez votre distributeur local :

MCP1 (CCL2) (NM_002982) Human Recombinant Protein

Other products for "MCP1 or NM_002982"

file-alt Citations

Vous serez peut-être également intéressé par les produits suivants :

Citations