MFN1 Antibody - middle region
Référence ARP57702_P050-25UL
Conditionnement : 25ul
Marque : Aviva Systems Biology
MFN1 Antibody - middle region (ARP57702_P050)
| Datasheets/Manuals | Printable datasheet for anti-MFN1 (ARP57702_P050) antibody |
|---|
| Publications | Bonala, S. et al. Pid1 induces insulin resistance in both human and mouse skeletal muscle during obesity. Mol. Endocrinol. 27, 1518-35 (2013). 23927930 Papanicolaou, K. N. et al. Mitofusin-2 maintains mitochondrial structure and contributes to stress-induced permeability transition in cardiac myocytes. Mol. Cell. Biol. 31, 1309-28 (2011). 21245373 |
|---|---|
| Tested Species Reactivity | Human, Mouse |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MFN1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MFN1 (ARP57702_P050) antibody is Catalog # AAP57702 (Previous Catalog # AAPP42948) |
| Enhanced Validation |
| Gene Symbol | MFN1 |
|---|---|
| Gene Full Name | Mitofusin 1 |
| Alias Symbols | hfzo1, hfzo2 |
| NCBI Gene Id | 55669 |
| Protein Name | Mitofusin-1 |
| Description of Target | The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting. |
| Uniprot ID | Q8R4Z9 |
| Protein Accession # | NP_284941 |
| Nucleotide Accession # | NM_033540 |
| Protein Size (# AA) | 741 |
| Molecular Weight | 84 kDa |
| Protein Interactions | PARK2; MARCH5; UBC; TER94; MAVS; CCNB1; ILF2; BAK1; |







