MTUS1 antibody - C-terminal region
Référence ARP44419_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
MTUS1 Antibody - middle region (ARP44419_P050)
| Datasheets/Manuals | Printable datasheet for anti-MTUS1 (ARP44419_P050) antibody |
|---|
| Publications | Reciprocal regulation of Aurora kinase A and ATIP3 in the control of metaphase spindle length Negative regulation of EB1 turnover at microtubule plus ends by interaction with microtubule-associated protein ATIP3 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MTUS1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MTUS1 (ARP44419_P050) antibody is Catalog # AAP44419 (Previous Catalog # AAPP25729) |
| Sample Type Confirmation | MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HeLa, HepG2 |
| Reference | Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693 |
|---|---|
| Gene Symbol | MTUS1 |
| Gene Full Name | Microtubule associated tumor suppressor 1 |
| Alias Symbols | ATBP, ATIP, ICIS, MP44, ATIP3, MTSG1 |
| NCBI Gene Id | 57509 |
| Protein Name | Microtubule-associated tumor suppressor 1 |
| Description of Target | MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. |
| Uniprot ID | Q9ULD2 |
| Protein Accession # | NP_001001924 |
| Nucleotide Accession # | NM_001001924 |
| Protein Size (# AA) | 1270 |
| Molecular Weight | 141kDa |
| Protein Interactions | UBC; MMS19; ORC4; Ptpn6; MTUS1; AGTR2; |
