N Recombinant Protein
Référence OPCA03372-100UG
Conditionnement : 100ug
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
N Recombinant Protein (RVFV) (OPCA03372)
| Datasheets/Manuals | Printable datasheet for N Recombinant Protein (RVFV) (OPCA03372) |
|---|
| Predicted Species Reactivity | Rift Valley Fever Virus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Rift valley fever virus |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA |
| Protein Sequence | MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 1-245 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Sequences and coding strategies of the S RNAs of Toscana and Rift Valley fever viruses compared to those of Punta Toro, Sicilian Sandfly fever, and Uukuniemi viruses.Giorgi C., Accardi L., Nicoletti L., Gro M.C., Takehara K., Hilditch C., Morikawa S., Bishop D.H.L.Virology 180:738-753(1991) |
|---|---|
| Gene Symbol | N |
| Alias Symbols | Nucleocapsid protein. |
| Protein Name | Nucleoprotein |
| Description of Target | Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. After replication, the nucleocapsid is recruited to the host Golgi apparatus by glycoprotein Gn for packaging into virus particles. |
| Uniprot ID | P21700 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 43.4 kda |
