OIF (OGN) (NM_033014) Human Recombinant Protein

Référence TP323948

Conditionnement : 20ug

Contactez votre distributeur local :


Téléphone :

OIF (OGN) (NM_033014) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323948
Recombinant protein of human osteoglycin (OGN), transcript variant 1, 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223948 representing NM_033014
Red=Cloning site Green=Tags(s)

MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS
LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA
DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK
KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG
KHPNSFICLKRLPIGSYF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_148935
Locus ID 4969
UniProt ID P20774
Cytogenetics 9q22.31
RefSeq Size 2976
RefSeq ORF 894
Synonyms OG; OIF; SLRR3A
Summary This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded protein induces ectopic bone formation in conjunction with transforming growth factor beta and may regulate osteoblast differentiation. High expression of the encoded protein may be associated with elevated heart left ventricular mass. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2016
Protein Categories Growth Factors, Intracellular Proteins, Secreated Proteins
Protein Families Secreted Protein
SKU Description Size
PH310651 OGN MS Standard C13 and N15-labeled recombinant protein (NP_054776) 10 ug
PH323948 OGN MS Standard C13 and N15-labeled recombinant protein (NP_148935) 10 ug
LC403216 Lyophilized OGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC411273 Lyophilized OGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC415500 Lyophilized OGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY403216 Transient overexpression lysate of osteoglycin (OGN), transcript variant 1 (as WB positive control) 100 ug
LY411273 Transient overexpression lysate of osteoglycin (OGN), transcript variant 2 (as WB positive control) 100 ug
LY415500 Transient overexpression lysate of osteoglycin (OGN), transcript variant 3 (as WB positive control) 100 ug
TP310651 Recombinant protein of human osteoglycin (OGN), transcript variant 3, 20 µg 20 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT