ompK Recombinant Protein
Référence OPCA03338-1MG
Conditionnement : 1mg
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
OMPK Recombinant Protein (Vibrio parahaemolyticus serotype O3:K6) (OPCA03338)
| Datasheets/Manuals | Printable datasheet for OMPK Recombinant Protein (Vibrio parahaemolyticus serotype O3:K6) (OPCA03338) |
|---|
| Predicted Species Reactivity | Vibrio parahaemolyticus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Vibrio parahaemolyticus |
| Additional Information | Relevance: Serves as receptor for a broad-host-range vibriophage, KVP40. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | ADYSDGDIHKNDYKWMQFNLMGAFDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDKGSDKVGDPKIFMKFAPRMSIDGLTGKDLSFGPVQELYVATLFEWDGTDYKTNPFSVNNQKVGIGSDVMVPWFGKVGVNLYGTYQGNQKDWNGFQISTNWFKPFYFFENGSFISYQGYIDYQFGMKEKYSSASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDSDALKSTGFGHYVAVTYKF |
| Protein Sequence | ADYSDGDIHKNDYKWMQFNLMGAFDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDKGSDKVGDPKIFMKFAPRMSIDGLTGKDLSFGPVQELYVATLFEWDGTDYKTNPFSVNNQKVGIGSDVMVPWFGKVGVNLYGTYQGNQKDWNGFQISTNWFKPFYFFENGSFISYQGYIDYQFGMKEKYSSASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDSDALKSTGFGHYVAVTYKF |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 21-266 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Genome sequence of Vibrio parahaemolyticus: a pathogenic mechanism distinct from that of V. cholerae.Makino K., Oshima K., Kurokawa K., Yokoyama K., Uda T., Tagomori K., Iijima Y., Najima M., Nakano M., Yamashita A., Kubota Y., Kimura S., Yasunaga T., Honda T., Shinagawa H., Hattori M., Iida T.Lancet 361:743-749(2003) |
|---|---|
| Gene Symbol | VP_RS11470 |
| Gene Full Name | outer membrane protein OmpK |
| Alias Symbols | outer membrane protein OmpK, VP_RS11470, VP2362. |
| NCBI Gene Id | 1189875 |
| Protein Name | Outer membrane protein OmpK |
| Description of Target | Serves as receptor for a broad-host-range vibriophage, KVP40. |
| Uniprot ID | P59570 |
| Protein Accession # | NP_798741.1 |
| Nucleotide Accession # | NC_004603.1 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 43.9 kDa |