OSBPL8 Antibody - middle region - Biotin
Référence ARP44454_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
OSBPL8 Antibody - middle region : Biotin (ARP44454_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-OSBPL8 (ARP44454_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human OSBPL8 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-OSBPL8 (ARP44454_P050-Biotin) antibody is Catalog # AAP44454 (Previous Catalog # AAPP25764) |
| Sample Type Confirmation | OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in HT1080, OVCAR3 |
| Gene Symbol | OSBPL8 |
|---|---|
| Gene Full Name | Oxysterol binding protein-like 8 |
| Alias Symbols | ORP8, MST120, OSBP10, MSTP120 |
| NCBI Gene Id | 114882 |
| Protein Name | Oxysterol-binding protein RuleBase RU003845 |
| Description of Target | OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. |
| Uniprot ID | Q68D75 |
| Protein Accession # | NP_001003712 |
| Nucleotide Accession # | NM_001003712 |
| Protein Size (# AA) | 847 |
| Molecular Weight | 97kDa |
| Protein Interactions | UBC; HECW2; MDC1; UBD; SIRT7; SQSTM1; |
