PACS2 Antibody - middle region - Biotin
Référence ARP51659_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
PACS2 Antibody - middle region : Biotin (ARP51659_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-PACS2 (ARP51659_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PACS2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: AHQLPIAEAMLTYKQKSPDEESSQKFIPFVGVVKVGIVEPSSATSGDSDD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PACS2 (ARP51659_P050-Biotin) antibody is Catalog # AAP51659 (Previous Catalog # AAPP30147) |
| Gene Symbol | PACS2 |
|---|---|
| Gene Full Name | Phosphofurin acidic cluster sorting protein 2 |
| Alias Symbols | DEE66, EIEE66, PACS-2, PACS1L |
| NCBI Gene Id | 23241 |
| Protein Name | Phosphofurin acidic cluster sorting protein 2 |
| Description of Target | PACS2 is the multifunctional sorting protein that controls the endoplasmic reticulum (ER)-mitochondria communication, including the apposition of mitochondria with the ER and ER homeostasis. In addition, in response to apoptic inducer,PACS2 translocates BIB to mitochondria, which initiates a sequence of events including the formation of mitochondrial truncated BID, the release of cytochrome c, the activation of caspase-3 thereby causing cell death.PACS2 may also be involved in ion channel trafficking, directing acidic cluster-containing ion channels to distinct subcellular compartments. |
| Uniprot ID | Q86VP3 |
| Protein Accession # | NP_056012 |
| Nucleotide Accession # | NM_015197 |
| Protein Size (# AA) | 889 |
| Molecular Weight | 98kDa |
| Protein Interactions | UBC; TRAF2; BIRC3; BIRC2; PKD2; BID; |
