PADI4 Antibody - middle region - Biotin
Référence ARP54888_P050-Biotin
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
PADI4 Antibody - middle region : Biotin (ARP54888_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-PADI4 (ARP54888_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PADI4 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 79%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: TGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQAL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PADI4 (ARP54888_P050-Biotin) antibody is Catalog # AAP54888 (Previous Catalog # AAPP31690) |
| Sample Type Confirmation | There is BioGPS gene expression data showing that PADI4 is expressed in 721_B |
| Reference | Costenbader,K.H., (er) Arthritis Res. Ther. 10 (3), R52 (2008) In press |
|---|---|
| Gene Symbol | PADI4 |
| Gene Full Name | Peptidyl arginine deiminase, type IV |
| Alias Symbols | PAD, PAD4, PDI4, PDI5, PADI5 |
| NCBI Gene Id | 23569 |
| Protein Name | Protein-arginine deiminase type-4 |
| Description of Target | PADI4 is an enzyme responsible for the conversion of arginine residues to citrulline residues. This protein may play a role in granulocyte and macrophage development leading to inflammation and immune response.This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q9UM07 |
| Protein Accession # | NP_036519 |
| Nucleotide Accession # | NM_012387 |
| Protein Size (# AA) | 663 |
| Molecular Weight | 74kDa |
| Protein Interactions | ANXA4; FBXO25; APP; ING4; ELK1; NPM1; TP53; HDAC2; HIST2H3A; HDAC1; TFF1; HIST4H4; HIST3H3; |
