PAX7 Antibody - C-terminal region
Référence ARP32742_P050
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
PAX7 Antibody - C-terminal region (ARP32742_P050)
| Datasheets/Manuals | Printable datasheet for anti-PAX7 (ARP32742_P050) antibody |
|---|
| Publications | Effects of 4-Aminopyridine on Combined Nerve and Muscle Injury and Bone Loss The vascularization, innervation and myogenesis of early regenerated tail in Gekko japonicus The primary cilium dampens proliferative signaling and represses a G2/M transcriptional network in quiescent myoblasts |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of PAX7 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PAX7 (ARP32742_P050) antibody is Catalog # AAP32742 |
| Gene Symbol | PAX7 |
|---|---|
| Gene Full Name | Paired box 7 |
| Alias Symbols | HUP1, RMS2, PAX7B, MYOSCO |
| NCBI Gene Id | 5081 |
| Protein Name | Paired box protein Pax-7 |
| Description of Target | PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown. |
| Uniprot ID | P23759 |
| Protein Accession # | NP_002575 |
| Nucleotide Accession # | NM_002584 |
| Protein Size (# AA) | 520 |
| Molecular Weight | 57kDa |
| Protein Interactions | TRIM27; MYOD1; Dlg4; WDR5; ASH2L; HIRA; Ubc; |
