Pdgfc Antibody - N-terminal region - FITC
Référence ARP61794_P050-FITC
Conditionnement : 100ul
Marque : Aviva Systems Biology
Contactez votre distributeur local :
Téléphone : +1 850 650 7790
Pdgfc Antibody - N-terminal region : FITC (ARP61794_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-Pdgfc (ARP61794_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Pdgfc |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Pdgfc (ARP61794_P050-FITC) antibody is Catalog # AAP61794 |
| Gene Symbol | Pdgfc |
|---|---|
| Gene Full Name | platelet derived growth factor C |
| Alias Symbols | PDGF-, SCDGF, PDGF-C, VEGF-E, AI647969, 1110064L01Rik |
| NCBI Gene Id | 54635 |
| Protein Name | Platelet-derived growth factor C |
| Description of Target | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton formation during embryonic development, especially for normal development of the craniofacial skeleton and for normal development of the palate. Required for normal skin morphogenesis during embryonic development. Plays an important role in wound healing, where it appears to be involved in three stages: inflammation, proliferation and remodeling. Plays an important role in angiogenesis and blood vessel development. Involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain has mitogenic activity in coronary artery smooth muscle cells, suggesting a role beyond the maintenance of the latency of the PDGF domain. In the nucleus, PDGFC seems to have additional function. |
| Uniprot ID | Q8CI19 |
| Protein Accession # | NP_064355 |
| Nucleotide Accession # | NM_019971 |
| Protein Size (# AA) | 345 |
| Molecular Weight | 39kDa |
